PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G03710.2
Common NameAGL3, F19B11.16, SEP4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MIKC_MADS
Protein Properties Length: 257aa    MW: 29486.2 Da    PI: 9.2511
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G03710.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.79.9e-31959151
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 krienk+nrqvtf+kRrng+lKKA+ELSvLCdae+a++ifs++gklye++s
  AT2G03710.2  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEIALLIFSNRGKLYEFCS 59
                 79***********************************************96 PP

2K-box87.52.6e-2982173899
        K-box   8 sleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                  ++++++ +  +q++ kLk+++e Lq++qRhllGe+L++++++eL++Le+q++ sl++iRs+K + +l+q+++l+ ke++l e+n++Lr+kle
  AT2G03710.2  82 NQSAKDLQDKYQDYLKLKSRVEILQHSQRHLLGEELSEMDVNELEHLERQVDASLRQIRSTKARSMLDQLSDLKTKEEMLLETNRDLRRKLE 173
                  36788999**********************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.0E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.137161IPR002100Transcription factor, MADS-box
CDDcd002656.84E-43277No hitNo description
SuperFamilySSF554553.79E-32278IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-32323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.8E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-323859IPR002100Transcription factor, MADS-box
PfamPF014866.6E-2486172IPR002487Transcription factor, K-box
PROSITE profilePS5129714.57588178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0048440Biological Processcarpel development
GO:0048441Biological Processpetal development
GO:0048442Biological Processsepal development
GO:0048443Biological Processstamen development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MGRGKVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEIALLIFSN RGKLYEFCSS  60
PSGMARTVDK YRKHSYATMD PNQSAKDLQD KYQDYLKLKS RVEILQHSQR HLLGEELSEM  120
DVNELEHLER QVDASLRQIR STKARSMLDQ LSDLKTKEEM LLETNRDLRR KLEDSDAALT  180
QSFWGSSAAE QQQQHQQQQQ GMSSYQSNPP IQEAGFFKPL QGNVALQMSH YNHNPANATN  240
SATTSQNVNG FFPGWMV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A3e-239317422103Developmental protein SEPALLATA 3
4ox0_B3e-239317422103Developmental protein SEPALLATA 3
4ox0_C3e-239317422103Developmental protein SEPALLATA 3
4ox0_D3e-239317422103Developmental protein SEPALLATA 3
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.102000.0bud| leaf| vegetative tissue
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible264041_at0.0
Expression AtlasAT2G03710-
AtGenExpressAT2G03710-
ATTED-IIAT2G03710-
Functional Description ? help Back to Top
Source Description
TAIRThis gene belongs to the family of SEP genes. It is involved in the development of sepals, petals, stamens and carpels. Additionally, it plays a central role in the determination of flower meristem and organ identity.
UniProtProbable transcription factor.
Function -- GeneRIF ? help Back to Top
  1. SEP4 contributes to the development of petals, stamens, carpels, sepals and plays an important role in meristem identity.
    [PMID: 15530395]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00030SELEX16381825Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G03710.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT2G03710, AT2G45660, AT5G23260, AT5G60910, AT1G31630, AT1G31640, AT1G46408, AT1G48150, AT1G69120, AT1G77980
IntActSearch P29383
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G03710
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0638940.0AY063894.1 Arabidopsis thaliana putative MADS-box protein AGL3 (At2g03710) mRNA, complete cds.
GenBankAY0963860.0AY096386.1 Arabidopsis thaliana putative MADS-box protein (AGL3) (At2g03710) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_849930.10.0protein SEPALLATA 4
SwissprotP293830.0AGL3_ARATH; Agamous-like MADS-box protein AGL3
TrEMBLD7LQK51e-172D7LQK5_ARALL; Predicted protein
STRINGAT2G03710.10.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  3. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. Gong W, et al.
    Genome-wide ORFeome cloning and analysis of Arabidopsis transcription factor genes.
    Plant Physiol., 2004. 135(2): p. 773-82
    [PMID:15208423]
  6. Ditta G,Pinyopich A,Robles P,Pelaz S,Yanofsky MF
    The SEP4 gene of Arabidopsis thaliana functions in floral organ and meristem identity.
    Curr. Biol., 2004. 14(21): p. 1935-40
    [PMID:15530395]
  7. Wang XJ,Cao XL,Hong Y
    Isolation and characterization of flower-specific transcripts in Acacia mangium.
    Tree Physiol., 2005. 25(2): p. 167-78
    [PMID:15574398]
  8. Albert VA, et al.
    Floral gene resources from basal angiosperms for comparative genomics research.
    BMC Plant Biol., 2005. 5: p. 5
    [PMID:15799777]
  9. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  10. Pina C,Pinto F,Feij
    Gene family analysis of the Arabidopsis pollen transcriptome reveals biological implications for cell growth, division control, and gene expression regulation.
    Plant Physiol., 2005. 138(2): p. 744-56
    [PMID:15908605]
  11. Kaufmann K,Anfang N,Saedler H,Theissen G
    Mutant analysis, protein-protein interactions and subcellular localization of the Arabidopsis B sister (ABS) protein.
    Mol. Genet. Genomics, 2005. 274(2): p. 103-18
    [PMID:16080001]
  12. Malcomber ST,Kellogg EA
    SEPALLATA gene diversification: brave new whorls.
    Trends Plant Sci., 2005. 10(9): p. 427-35
    [PMID:16099195]
  13. Ma H,Yanofsky MF,Meyerowitz EM
    AGL1-AGL6, an Arabidopsis gene family with similarity to floral homeotic and transcription factor genes.
    Genes Dev., 1991. 5(3): p. 484-95
    [PMID:1672119]
  14. Popescu SC, et al.
    Differential binding of calmodulin-related proteins to their targets revealed through high-density Arabidopsis protein microarrays.
    Proc. Natl. Acad. Sci. U.S.A., 2007. 104(11): p. 4730-5
    [PMID:17360592]
  15. Matias-Hernandez L, et al.
    VERDANDI is a direct target of the MADS domain ovule identity complex and affects embryo sac differentiation in Arabidopsis.
    Plant Cell, 2010. 22(6): p. 1702-15
    [PMID:20581305]
  16. Liu C, et al.
    A conserved genetic pathway determines inflorescence architecture in Arabidopsis and rice.
    Dev. Cell, 2013. 24(6): p. 612-22
    [PMID:23537632]
  17. Jetha K,Thei
    Arabidopsis SEPALLATA proteins differ in cooperative DNA-binding during the formation of floral quartet-like complexes.
    Nucleic Acids Res., 2014. 42(17): p. 10927-42
    [PMID:25183521]
  18. Huang H,Tudor M,Weiss CA,Hu Y,Ma H
    The Arabidopsis MADS-box gene AGL3 is widely expressed and encodes a sequence-specific DNA-binding protein.
    Plant Mol. Biol., 1995. 28(3): p. 549-67
    [PMID:7632923]